PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D07G1261
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 403aa    MW: 45007.1 Da    PI: 4.8626
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D07G1261genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding47.73.6e-151461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +grWT+eEd ll ++++  G g+W++ ++  g+ R++k+c++rw +yl
      Gh_D07G1261 14 KGRWTAEEDVLLTKYIQANGEGSWRSLPKNAGLLRCGKSCRLRWINYL 61
                     79******************************99************97 PP

2Myb_DNA-binding54.33.2e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg++T +E+e ++++++ lG++ W++Ia++++ gRt++++k++w+++l
      Gh_D07G1261  67 RGNFTSQEEEVIINLHATLGNR-WSLIASYLP-GRTDNEIKNYWNSHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.0E-20564IPR009057Homeodomain-like
PROSITE profilePS5129415.106961IPR017930Myb domain
SuperFamilySSF466892.37E-2811108IPR009057Homeodomain-like
SMARTSM007173.1E-111363IPR001005SANT/Myb domain
PfamPF002492.0E-131461IPR001005SANT/Myb domain
CDDcd001674.37E-81661No hitNo description
PROSITE profilePS5129425.17362116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-2565116IPR009057Homeodomain-like
SMARTSM007174.3E-1666114IPR001005SANT/Myb domain
PfamPF002492.8E-1567112IPR001005SANT/Myb domain
CDDcd001677.06E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 403 aa     Download sequence    Send to blast
MGRAPCCEKV GLKKGRWTAE EDVLLTKYIQ ANGEGSWRSL PKNAGLLRCG KSCRLRWINY  60
LRADLKRGNF TSQEEEVIIN LHATLGNRWS LIASYLPGRT DNEIKNYWNS HLSRKIHSFR  120
RPLTQSMPVI MDLTKTAVIA KRKGGRTSEG SMKENKSCST QKDTGSCSNK PTENVCVNEV  180
VPFPSTPLLE KETLSTTAIE DRMVLDQHGE DKERTTHVVP SPCHDTVVEG MLGSSEERES  240
LVSEEGTIEN SMQCPSGNAE KGTGILAPHE SIDSSEIEWF NDILDSELLQ PSGDLTFTEL  300
GEDSGNVKTH TTAANNEEIV SRNCSADSGG DLSSCTSTTF YFVDDWEWEN VVPRSELWDE  360
KEYMCSWLWE PSDYHGKGER HKVDDNGFEG HNPMIAANAS LFS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C3e-241211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO29213350.0
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00627PBMTransfer from PK06182.1Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF0341320.0AF034132.1 Gossypium hirsutum MYB-like DNA-binding domain protein (MYB4) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012479507.10.0PREDICTED: LOW QUALITY PROTEIN: myb-related protein Zm1
TrEMBLA0A0D2N9K20.0A0A0D2N9K2_G
STRINGPOPTR_0002s19920.11e-103(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM17349511
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47460.19e-75myb domain protein 12